PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00595.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 274aa    MW: 31392.3 Da    PI: 9.585
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00595.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.4e-192067148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd ll+d+v+++G g+W+++ar  g++R +k+c++rw +yl
  Rsa1.0_00595.1_g00016.1 20 KGPWTAEEDRLLIDYVRLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 67
                             79********************************************97 PP

2Myb_DNA-binding543.9e-1773117147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg  T+ E+++++++++++G++ W+tIar ++ gRt++++k++w+++
  Rsa1.0_00595.1_g00016.1  73 RGQITPHEEKIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 117
                              7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8061571IPR017930Myb domain
SuperFamilySSF466891.17E-3017114IPR009057Homeodomain-like
SMARTSM007177.2E-171969IPR001005SANT/Myb domain
PfamPF002491.0E-172067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-242174IPR009057Homeodomain-like
CDDcd001674.48E-122267No hitNo description
PROSITE profilePS5129419.77672122IPR017930Myb domain
SMARTSM007172.1E-1572120IPR001005SANT/Myb domain
PfamPF002491.5E-1473117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2475121IPR009057Homeodomain-like
CDDcd001679.03E-1177118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSLWGVMGAG WGTVEEGWRK GPWTAEEDRL LIDYVRLHGE GRWNSVARLA GLKRNGKSCR  60
LRWVNYLRPD LKRGQITPHE EKIILELHAK WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK  120
KTKSPTNNAE KTKNRILKRQ QFQQQRQMEL QQEQQLLQLN QIDMKKIMSL LEEDNNHNNG  180
DNNFSSSSSG SSGEGGAFYV PHQITHSTTN SGYDSNGNGL FRVVPMPLPE ANLHEEYAIW  240
DGLWNLDLEG QGSFSGGACV PRKPCFQNLA IPFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106000.11e-164PREDICTED: transcription factor WER-like
TrEMBLM4EHV41e-164M4EHV4_BRARP; Uncharacterized protein
STRINGBra028369.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-130myb domain protein 305